method validation is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-07-04. Numbers and descriptions here follow the published literature rather than marketing material.
Routine quality control monitors retention time shifts, baseline noise, system pressure, and peak shape. Trends can reveal column aging, mobile phase preparation errors, detector drift, or sample degradation. Corrective actions may include replacing the column, preparing fresh mobile phase, or recalibrating the detector. Stability testing often uses HPLC to measure parent compound loss and degradation product formation. Open questions remain about how accelerated stability results extrapolate to long-term storage under varied conditions.
Quality control for HPLC testing combines scheduled checks, documented procedures, and review of results. Before sample analysis, system suitability testing confirms that the instrument, column, and method meet predefined criteria. Common criteria include resolution between critical peaks, retention time precision, peak tailing, and theoretical plate count. Failure triggers investigation before results are reported. Records link raw data, calculations, instrument logs, and analyst identity to each batch, supporting audits and repeat analysis.
Method validation evaluates accuracy, precision, specificity, linearity, range, detection limit, quantitation limit, and robustness. Regulatory guidance for pharmaceuticals, foods, and environmental testing defines expected documentation and acceptance criteria. Verification confirms that a validated method works in a specific laboratory with its own instruments and reagents. Calibration curves use reference standards with known purity and traceability, while measurement uncertainty is estimated from validation data, control charts, and collaborative studies. The scope of validation depends on the method's intended use.
Separation in HPLC depends on the chemistry of the stationary phase, the composition of the mobile phase, and the physical properties of the column. Reverse-phase separations use a nonpolar stationary phase and a polar mobile phase, and they are common for many organic compounds. Ion-exchange, size-exclusion, and normal-phase modes serve other classes of analytes. Gradient elution changes solvent strength over time, while isocratic elution holds it constant. Flow rate, temperature, particle size, and column length all influence peak shape and resolution. Detection may use ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry, depending on the analyte and the required sensitivity.
Routine HPLC testing compares a sample result with a calibration curve prepared from known reference standards. Peak area or peak height is plotted against concentration, and the curve is used to estimate unknown amounts. Retention time supports tentative identification when compared with a standard, though mass spectrometry or another confirmatory method may be needed for definitive identification. Pre-run checks verify repeatability, resolution, and peak symmetry before sample analysis. Limits of detection and quantification describe the smallest amounts that can be reliably observed or measured. Sample preparation, filtration, and degassing help prevent column damage and inconsistent results.
| Property | Value | Notes |
|---|---|---|
| Retention time RSD | ≤1% for five replicate injections | Typical criterion; method-specific limits apply. |
| Resolution | ≥1.5 between critical pair | Baseline separation is generally desired. |
| Tailing factor | ≤2.0 | Measures peak symmetry. |
| Theoretical plates | ≥2000 per column | Method-dependent; higher values indicate greater efficiency. |
| Peak area RSD | ≤2% for replicate injections | Reflects autosampler and detector precision. |
Separation performance depends on particle size, pore size, column length, and the chemistry of the stationary phase. Smaller particles generally improve efficiency but require higher pressure and suitable instrumentation. The mobile phase often contains buffers and organic solvents that influence retention and selectivity. Testing labs select conditions based on the analytes, sample matrix, and required sensitivity. Method development frequently involves screening several columns and solvent mixtures before a final set of conditions is chosen.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample by passing them through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in how analytes partition between the mobile phase and the stationary phase cause them to exit the column at different times. Detection then records a signal proportional to the amount of each separated substance. The resulting chromatogram provides retention times and peak areas for identification and quantification.
Method validation demonstrates that an analytical procedure is suitable for its intended purpose. Typical validation characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulatory guidance from bodies such as the International Council for Harmonisation and the United States Pharmacopeia outlines expectations, though specific criteria depend on the product and method. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, column efficiency, and injection repeatability. Failure of these checks can invalidate a batch of measurements.
Practical HPLC testing depends on careful sample preparation and instrument maintenance. Samples may require filtration, dilution, pH adjustment, or extraction to avoid column damage and matrix interference. Mobile phases are degassed and filtered, and columns are equilibrated before injection. Common problems include peak tailing, baseline drift, ghost peaks, carryover, and co-elution of analytes. Documentation of instrument logs, calibration records, and electronic audit trails supports data integrity and traceability. Ongoing training and routine maintenance help reduce variability between analysts and laboratories.
Insects have two types of "blood sugar", the monosaccharide glucose and the disaccharide trehalose. Trehalose is the major carbohydrate used by insects for flight. The concentrations of the carbohydrates trehalose and glucose in the insect hemolymph are tightly controlled by multiple enzymes and hormones, including trehalase, insulin-like peptides (ILPs and DILPs), adipokinetic hormone (AKH), leucokinin (LK), octopamine and other mediators, thereby maintaining carbohydrate homeostasis by endocrine and metabolic feedback mechanisms.
Nickel-61 is the only stable isotope of nickel with a nuclear spin (I = 3/2), which makes it useful for studies by EPR spectroscopy. Nickel-62 has the highest binding energy per nucleon of any isotope for any element, when including the electron shell in the calculation, though iron-56 has the lower mass-energy per nucleon. Though fusion could form heavier isotopes exothermically - for example, two 40Ca atoms could make 80Kr (with 4 positron decays) and liberate 77 keV per nucleon - reactions leading to the iron/nickel region are more probable as they release more energy in total.
Like other cluster decays, alpha decay is fundamentally a quantum tunneling process. Unlike beta decay, it is governed by the interplay between both the strong nuclear force and the electromagnetic force. Alpha particles have a typical kinetic energy of 5 MeV (or ≈ 0.13% of their total energy, 110 TJ/kg) and have a speed of about 15,000,000 m/s, or 5% of the speed of light. There is surprisingly small variation around this energy, due to the strong dependence of the half-life of this process on the energy produced. Because of their relatively large mass, the electric charge of +2 e and relatively low velocity, alpha particles are very likely to interact with other atoms and lose their energy, and their forward motion can be stopped by a few centimeters of air. Approximately 99% of the helium produced on Earth is the result of the alpha decay of underground deposits of minerals containing uranium or thorium. The helium is brought to the surface as a by-product of natural gas production.
RU-24213, also known as 3-hydroxy-N-propyl-N-(phenylethyl)phenethylamine, is a dopamine receptor agonist of the phenethylamine family related to dopamine. It is a selective dopamine D2-like receptor agonist. Subsequently, however, RU-24213 was found to also act as a potent κ-opioid receptor (KOR) antagonist. It led to the development of the diphenylethylamine series of KOR ligands. RU-24213 was first described in the scientific literature in 1978.
Sources: en.wikipedia.org
=== Leukocyte adhesion deficiency and the "multistep paradigm" === Working with physicians seeing patients with recurring, life-threatening bacterial infections, Springer found their leukocytes lacked LFA-1 (αLβ2), Mac-1 (αMβ2), and αXβ2. Anderson and Springer named the disease leukocyte adhesion deficiency (LAD) in a review article, and it was shown to be caused by mutations in the β2 subunit common to the leukocyte integrins. Patients have abnormally high levels of neutrophils in their circulation, which cannot emigrate out of the bloodstream to fight infection. This demonstrated that β2 integrins were important in leukocyte interactions with vascular endothelial cells and stimulated Springer to set up work in the lab on endothelial cells and flow chambers. In related work on LFA-1 ligands, ICAM-1 and ICAM-2 were shown to be inducible and constitutively expressed, respectively, on endothelium. It had long been known from intravital microscopy that leukocyte emigration involved leukocyte rolling on endothelium followed by firm adhesion and subsequent transendothelial migration. Using white blood cells infused in flow chambers and purified adhesion molecules on the chamber walls under physiological shear rates found in vivo, Springer and postdoctoral fellow Mike Lawrence reconstituted three sequential interactions required for leukocyte emigration. Flow chamber walls were coated with P-selectin, ICAM-1, or both. Infused neutrophils were found to readily attach and then roll on P-selectin, but could not attach to ICAM-1 in flow.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
==== History ==== Early measurements of thorium isomers were performed via gamma ray spectroscopy, producing the 29.5855 keV excited state of 229Th, and measuring the difference in emitted gamma ray energies as it decays to either the 229mTh (90%) or 229Th (10%) isomeric states. In 1976, Kroger and Reich sought to understand coriolis force effects in deformed nuclei, and attempted to match thorium's gamma-ray spectrum to theoretical nuclear shape models. To their surprise, the known nuclear states could not be reasonably classified into different total angular momentum quantization levels. They concluded that some states previously identified as 229Th actually arose from a spin-3/2 nuclear isomer, 229mTh, with a remarkably low excitation energy. At that time the energy was inferred to be below 100 eV, purely based on the non-observation of the isomer's direct decay. However, in 1990, further measurements led to the conclusion that the energy is almost certainly below 10 eV, making it one of the lowest known isomeric excitation energies. In the following years, the energy was further constrained to 3.5±1.0 eV, which was for a long time the accepted energy value. Improved gamma ray spectroscopy measurements using an advanced high-resolution X-ray microcalorimeter were carried out in 2007, yielding a new value for the transition energy of 7.6±0.5 eV, corrected to 7.8±0.5 eV in 2009. Earlier attempts to observe emitted photons had been doomed by a failure to consider two consequences of this higher energy:
== Patient population == The United States Food and Drug Administration and the European Medicines Agency have approved weight loss medications for adults with either a body-mass index (BMI) of at least 30, or a body-mass index of at least 27 with at least one weight-related comorbidity. This patient population is considered to have sufficiently high baseline health risks to justify the use of anti-obesity medication. The American Academy of Pediatrics had not previously supported the use of weight loss medication in adolescents but issued new guidelines in 2023, which recommend considering the use of weight loss medication in some overweight children aged 12 or older. The European Medicines Agency has approved semaglutide for children aged 12 or older who have a BMI in the 95 percentile for their age and a weight of at least 60 kilograms (130 lb). However, GLP-1 agonists may not be cost effective in this population.
Thermoplastic polymers Thermoset polymers Dendrimers Vitrimers / Covalent adaptable networks (CANs) Covalent organic frameworks (COFs) When considering organometallic materials within the scope, this may also include metal organic frameworks (MOFs). Additionally, when also considering other non-covalent bonding, such as hydrogen bonds or pi-stacking many different types of supramolecular networks are also included.
Sources: en.wikipedia.org
System suitability is typically performed before each batch or according to the validated method and laboratory procedure. Some long runs include periodic checks during analysis. The required frequency depends on regulatory expectations and method performance.
Retention time drift can result from changes in mobile phase composition, column temperature, pump flow, or column age. A gradual shift often points to column degradation. A sudden shift may indicate a leak, mixing error, or incorrect mobile phase.
Retention time alone cannot confirm identity because different compounds may elute at similar times. Coupling HPLC with mass spectrometry or comparing against authenticated standards increases confidence. Confirmation usually requires orthogonal data.
HPLC testing measures the presence and amount of one or more compounds in a liquid sample. It separates mixture components and records detector responses as peaks, which are compared with reference standards. Results are usually reported as concentrations or relative percentages.