The short version of reversed-phase fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-08-01 and is reviewed periodically as new material appears.
Separation performance depends on particle size, pore size, column length, and the chemistry of the stationary phase. Smaller particles generally improve efficiency but require higher pressure and suitable instrumentation. The mobile phase often contains buffers and organic solvents that influence retention and selectivity. Testing labs select conditions based on the analytes, sample matrix, and required sensitivity. Method development frequently involves screening several columns and solvent mixtures before a final set of conditions is chosen.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample by passing them through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in how analytes partition between the mobile phase and the stationary phase cause them to exit the column at different times. Detection then records a signal proportional to the amount of each separated substance. The resulting chromatogram provides retention times and peak areas for identification and quantification.
Instrumentation includes a solvent delivery system, an autosampler, a column oven, and one or more detectors. Reversed-phase columns with chemically modified silica are widely used, but normal-phase, ion-exchange, size-exclusion, and affinity modes exist for specific separations. Detectors may rely on ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry. Column temperature, mobile phase composition, and flow rate are adjusted to improve resolution. System pressure is monitored because rising pressure can indicate column blockage or deteriorating packing.
Several separation modes exist, including reversed-phase, normal-phase, ion-exchange, size-exclusion, and hydrophilic interaction liquid chromatography. Reversed-phase uses a nonpolar stationary phase with a polar mobile phase and is widely applied to small organic molecules. Gradient elution changes mobile phase composition during the run, while isocratic elution keeps it constant. Column chemistry, particle size, temperature, flow rate, and mobile phase pH all influence retention and resolution. Method development selects conditions that separate analytes from matrix components and from each other.
Detection commonly uses ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. Ultraviolet detection depends on molecular chromophores that absorb light at specific wavelengths. Mass spectrometry provides mass information and sensitive quantification, often after electrospray ionization. Before sample batches, performance checks examine resolution, elution time repeatability, peak symmetry, and plate count. Matrix effects and co-elution remain recognized uncertainties; formal validation studies and orthogonal detection help address them. Detector choice depends on analyte properties and required sensitivity.
| Property | Value | Notes |
|---|---|---|
| Separation principle | Differential partitioning | Analytes distribute between mobile and stationary phases. |
| Mobile phase | Liquid solvent mixture | Composition controls retention and selectivity. |
| Stationary phase | Packed column particles | Often chemically bonded silica. |
| Typical detector | UV-Vis or photodiode array | Mass spectrometry is also common. |
| Common synonym | High-performance liquid chromatography | Abbreviated as HPLC. |
High-performance liquid chromatography testing separates components of a liquid sample by forcing a mobile phase through a packed column. The stationary phase inside the column interacts with analytes to different degrees, so each compound exits at a characteristic retention time. A pump delivers solvent at controlled flow and pressure, while an injector introduces a precise sample volume. Detectors such as ultraviolet-visible, fluorescence, refractive index, or mass spectrometric instruments record the separated bands. The resulting chromatogram provides qualitative and quantitative information about the mixture.
Separation modes differ by the chemistry of the stationary phase and the composition of the mobile phase. Reversed-phase testing uses a nonpolar column and polar solvents, making it common for pharmaceutical, environmental, and food analytes. Normal-phase testing uses a polar column and nonpolar solvents for compounds that are poorly retained in reversed-phase systems. Ion-exchange and ion-pair methods separate charged species, while size-exclusion methods sort molecules by hydrodynamic volume. Gradient elution changes solvent strength over time to resolve complex mixtures, and isocratic elution holds solvent composition constant for simpler assays.
Method validation demonstrates that an analytical procedure is suitable for its intended purpose. Typical validation characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulatory guidance from bodies such as the International Council for Harmonisation and the United States Pharmacopeia outlines expectations, though specific criteria depend on the product and method. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, column efficiency, and injection repeatability. Failure of these checks can invalidate a batch of measurements.
Practical HPLC testing depends on careful sample preparation and instrument maintenance. Samples may require filtration, dilution, pH adjustment, or extraction to avoid column damage and matrix interference. Mobile phases are degassed and filtered, and columns are equilibrated before injection. Common problems include peak tailing, baseline drift, ghost peaks, carryover, and co-elution of analytes. Documentation of instrument logs, calibration records, and electronic audit trails supports data integrity and traceability. Ongoing training and routine maintenance help reduce variability between analysts and laboratories.
Quality control laboratories use HPLC to check identity, purity, concentration, and stability of raw materials and finished products. A validated method specifies the column, mobile phase, flow rate, detection wavelength, injection volume, and run time. Samples are prepared and compared against reference standards of known concentration. The resulting chromatogram provides quantitative data, such as assay values and impurity levels. This approach is common in pharmaceutical, food, environmental, and industrial testing where consistent measurements are required.
=== Uniforms === Battledress - Used until the 1960s Boots, General Service Khaki drill Denison smock - Used in airborne units until the 1970s 1950 Pattern Jungle Green Dress Boots, Tropical Jungle 1960 Pattern Combat Dress - Produced in olive green and then in Disruptive Pattern Material. Boots, Directly Moulded Sole 1968 Pattern No. 8 Combat Dress - Produced in Disruptive Pattern Material. Smock Parachutist DPM Lightweight Trousers - Produced in olive green No. 9 Tropical Dress 1984 Pattern Combat Dress Boots, Combat, High
=== LFA-1 and LFA-3–based therapeutics for autoimmune disease === Although Springer made the first antibodies to LFA-1 and LFA-3, he did not patent them. An antibody isolated by Hildreth and McMichael was licensed to Genentech, which was humanized and approved by the FDA in 2003 for moderate to severe psoriasis as Raptiva. Its generic name efalizumab simulate the letters F and L in LFA-1. Springer and lab member Mike Dustin collaborated with Barbara Wallner at Biogen to clone the cDNA for LFA-3. The LFA-3 ectodomain, which contains one immunoglobulin-like domain, was fused to the Fc domain of IgG to create Amevive. Amevive was approved for moderate to severe psoriasis in 2003. Its generic name, alefacept, is a homophone of LFA plus "cept" from receptor. Royalties paid by Biogen to Dana Farber Cancer Institute were equally shared by Dustin and Springer.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Increased rates of immune system disorders and other wide-ranging symptoms, including chronic pain, fatigue and memory loss, have been reported in over one quarter of combat veterans of the 1991 Gulf War. Combustion products from depleted uranium munitions are being considered as one of the potential causes by the Research Advisory Committee on Gulf War Veterans' Illnesses, as DU was used in 30 mm and 25 mm cannon rounds on a large scale for the first time in the Gulf War. Veterans of the conflicts in the Persian Gulf, Bosnia and Kosovo have been found to have up to 14 times the usual level of chromosome abnormalities in their genes. Serum-soluble genotoxic teratogens produce congenital disorders, and in white blood cells causes immune system damage. A 2005 epidemiology review concluded: "In aggregate the human epidemiological evidence is consistent with increased risk of birth defects in offspring of persons exposed to DU." A 2001 study of 15,000 February 1991 U.S. Gulf War combat veterans and 15,000 control veterans found that the Gulf War veterans were 1.8 (fathers) to 2.8 (mothers) times as likely to have children with birth defects. After examination of children's medical records two years later, the birth defect rate increased by more than 20%:
Sources: en.wikipedia.org
== History == Cambrex was founded in 1979, when the Ennis Family acquired the castor oil and derivatives product lines from NL Industries. In 1987, CasChem was renamed Cambrex Corporation and became listed on NASDAQ. In 1990, Cambrex was listed on the NYSE. Cambrex entered the pharmaceutical market in 1994 with the acquisition of Nobel Pharma Chemistry business, now known as Cambrex Karlskoga AB and Cambrex Profarmaco. Through multiple acquisitions during the late 1990s, the firm entered the bioscience and the chiral enzymatic catalyst markets. Cambrex acquired two contract biopharmaceutical manufacturing facilities in 2001, to bulk manufacture biologics and pharmaceutical ingredients from clinical to commercial scales. In 2007, the firm decided to focus on its core competencies and sold the biologics business to Lonza Group. In 2008, Prosyntest (now Cambrex Tallinn) was acquired, and Steve Klosk was appointed CEO, while remaining President. To broaden their biocatalysis platform, Cambrex acquired IEP in 2010, now known as Cambrex IEP. In 2019, Cambrex acquired Avista Pharma Solutions for $252m to become a fully integrated CDMO. In late 2019, Cambrex was acquired by an affiliate of the Permira funds. In 2020, Cambrex completed a major expansion at its Edinburgh, UK facility known for solid form screening alongside a biopharmaceutical expansion at its Durham, NC facility. Thomas Loewald was appointed CEO of Cambrex in September 2020. In 2022, Cambrex acquired Q1 Scientific, based out of Waterford, Ireland.
=== Rotator cuff disease === A 2022 review and meta-analysis showed improved patient-rated outcomes in patients with partial rotator cuff tears. At 8 weeks post injection, they found PRP to be effective. A 2021 prospective study examined the effectiveness of PRP for partial thickness rotator cuff tears. Patients were given 2 separate PRP injections and followed for 2 years. The study noted: "No adverse events were seen in any patient. Based on global rating scores positive results were seen in 77.9 % of patients at 6 months, 71.6 % at 1 year, and 68.8 % of patients at 2 years". They found PRP most effective in more damaged tendons. A 2021 meta-analysis found that PRP was effective for partial rotator cuff tears but the effects were no longer evident at 1 year. PRP has been shown to be superior to cortisone injections in several studies. This is especially evident in the longer term. A 2019 review found it not to be useful in rotator cuff disease. A 2018 review found that it may be useful. A 2009 review found few randomized controlled trials that adequately evaluated the safety and efficacy of PRP treatments and concluded that PRP was "a promising, but not proven, treatment option for joint, tendon, ligament, and muscle injuries".
For human and animal health, both the FDA and the EC have regulated the content levels of toxins in food and animal feed. Fusaric acid Fusarochromanone Kojic acid Lolitrem B Moniliformin 3-Nitropropionic acid Nivalenol Ochratoxins – In Australia, The Limit of Reporting (LOR) level for ochratoxin A (OTA) analyses in 20th Australian Total Diet Survey was 1 μg/kg, whereas the EC restricts the content of OTA to 5 μg/kg in cereal commodities, 3 μg/kg in processed products and 10 μg/kg in dried vine fruits. Oosporeine Patulin – Currently, this toxin has been advisably regulated on fruit products. The EC and the FDA have limited it to under 50 μg/kg for fruit juice and fruit nectar, while limits of 25 μg/kg for solid-contained fruit products and 10 μg/kg for baby foods were specified by the EC. Phomopsins Sporidesmin A Sterigmatocystin Tremorgenic mycotoxins – Five of them have been reported to be associated with molds found in fermented meats. These are fumitremorgen B, paxilline, penitrem A, verrucosidin, and verruculogen. Trichothecenes – sourced from Cephalosporium, Fusarium, Myrothecium, Stachybotrys, and Trichoderma. The toxins are usually found in molded maize, wheat, corn, peanuts and rice, or animal feed of hay and straw. Four trichothecenes, T-2 toxin, HT-2 toxin, diacetoxyscirpenol (DAS), and deoxynivalenol (DON) have been most commonly encountered by humans and animals. The consequences of oral intake of, or dermal exposure to, the toxins will result in alimentary toxic aleukia, neutropenia, aplastic anemia, thrombocytopenia and/or skin irritation.
Sources: en.wikipedia.org
Leisure activities were found to have the largest impact on individuals because these activities were the most self-directed of the three domains, as adolescents had the choice of activity, and were more likely to be able to align it with their true selves. The study found that subjective experiences were more important than the activities themselves and that adolescents reported higher levels of well-being. They reported that when adolescents express themselves through self-defining activities across multiple domains, they have a clearer image of themselves, of what they want to achieve and higher wellness. Goal-setting was found to be a unique predictor; when adolescents work towards goals set by themselves and accomplish them, they are likely to have a clearer emerging identity and higher well-being. Researchers found that more adolescents were happy when they were involved in self-chosen activities because the activities were chosen in line with their true self.
== Academic career == Beynon took a position as Professor of Chemistry and Director of the Mass Spectrometry Center at Purdue University in 1968. In 1974 Beynon accepted a position as Royal Society Research Professor and Director of the Mass Spectrometry Research Unit at Swansea University.
Lücking (2020) notes that the cladistic era laid the groundwork that made the transition to molecular phylogenetics relatively seamless: researchers already expected to use computers and algorithms, understood the importance of synapomorphies, and were prepared to revise taxonomy when evidence demanded. Cladistics ended the idea of lichen exceptionalism: lichens now had to fit into the tree of life under the same systematic rules as other organisms. System‑wide name curation entered a new phase in 1982 when Ove Eriksson issued the first Outline of the Ascomycetes, a periodically updated checklist that synthesized every formal taxonomic change. Retitled Outline of Ascomycota in 1999 and maintained through successive editions by Eriksson, Thorsten Lumbsch, Amy Huhndorf and collaborators, the living document functioned as a community "open‑source" ledger. Its numbered notes traced each genus‑level move and provided a stable reference frame that eased the transition from morphology‑based to molecule‑based systematics, right up to the final 2010 update.
In 80–85% of cases, the ALK detected in ALK-positive ALCL is a NPM1-ALK fusion protein. It is made by a fusion of NPM1 gene, which makes nucleophosmin 1, located on the long or "q" arm of chromosome 5 at position 35 (notated as 5q35) with the ALK gene located on the short or "p" arm of chromosome 2 at position 23 (notated as 2p23) to form a chimeric gene notated as (2;5)(p23;q35). In 13% of cases ALK fuses with the TPM3 gene or in <1% of cases for each of the following genes: TFG, ATIC, CLTC, TPM4, MSN, RNF213 (also termed ALO17), MYH9, or TRAF1. All of these fusion proteins are considered to act like NPMI-ALK in possessing high ALK activity that promotes the development and progression ALK-positive ALCL by activating the cell signaling pathways cited in the Introduction. 15% Of individuals with ALK-positive ALCL also have point mutations in the NOTCH1 gene. While most of these abnormalities are thought to be detrimental not all are. For example, DUSP22 gene rearrangements are associated with favorable outcomes in ALK-positive (as well as ALK-negative) ALCL.
Sources: en.wikipedia.org
HPLC separates and detects individual compounds in a liquid sample, producing peaks at characteristic retention times. Peak area or height can be used to estimate concentration when calibrated with known standards. It does not identify unknown compounds with certainty unless additional detectors or reference materials are used.
Pressure drives the liquid mobile phase through a column packed with small particles. Without pressure, flow would be very slow or stop because the packed bed resists liquid movement. Modern pumps maintain a steady flow despite the resistance.
A chromatogram is a plot of detector signal against time after sample injection. Each peak represents a compound or group of compounds eluting from the column. Retention time and peak area are the main measurements read from the plot.
HPLC separates and quantifies compounds in a liquid sample. Detectors produce a response proportional to the amount of a compound passing through the flow cell. Identification by retention time requires comparison with a known standard.